(data stored in ACNUC7421 zone)

EMBL: CP001720.PE125

CP001720.PE125       Location/Qualifiers
FT   CDS             complement(134383..135282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0127"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: vsa:VSAL_I2119
FT                   phosphate ABC transporter, inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61090"
FT                   /db_xref="GOA:C8W2T4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T4"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ACV61090.1"
FT                   /translation="MNIFKNRSKLLDRLMDIFCLAISICATLLLLAVIAFMIRESGPVW
FT                   LTAGPVKIITGTEWNPVLKPPQLGIGTMICSTLWTSLGAIFLASPLGFGGAVFLSEFAP
FT                   DWLAGIIRPVLNILTGIPSVVYGFLGATVLVKFFEFSFHMASGESLFCASLVLTVMVLP
FT                   YIVVASESALRSVPSEYRQAALALGVSKQYLTFRVLLPLAKKGLLGALILGFGRAAGET
FT                   MAVLMLAGNSLLMPTSWFSRGEPLSALIALEIGTSEVGSPQYQALFAAGLILLSFIIGI
FT                   NLFLTFLRRPVGNEVRKS"
     MNIFKNRSKL LDRLMDIFCL AISICATLLL LAVIAFMIRE SGPVWLTAGP VKIITGTEWN        60
     PVLKPPQLGI GTMICSTLWT SLGAIFLASP LGFGGAVFLS EFAPDWLAGI IRPVLNILTG       120
     IPSVVYGFLG ATVLVKFFEF SFHMASGESL FCASLVLTVM VLPYIVVASE SALRSVPSEY       180
     RQAALALGVS KQYLTFRVLL PLAKKGLLGA LILGFGRAAG ETMAVLMLAG NSLLMPTSWF       240
     SRGEPLSALI ALEIGTSEVG SPQYQALFAA GLILLSFIIG INLFLTFLRR PVGNEVRKS        299
//

If you have problems or comments...

PBIL Back to PBIL home page