(data stored in ACNUC7421 zone)

EMBL: CP001720.PE126

CP001720.PE126       Location/Qualifiers
FT   CDS             complement(135457..136380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0128"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; KEGG:
FT                   vch:VCA0070 phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61091"
FT                   /db_xref="GOA:C8W2T5"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T5"
FT                   /inference="protein motif:TFAM:TIGR02136"
FT                   /protein_id="ACV61091.1"
FT                   /translation="MKKRSFLSIISLLLGLFLLAGCSQNQQAQTEQIKDTEGQAYSIKI
FT                   GGSSTLSPVIAKCADNFTEKYKTWNKIDPKLPEEAITIFVSSGGSGFGVKSTINGTVDI
FT                   GLASREITNSEKEKMAKGNIFKMGSDALTIAVNPQNPVLKVKPNLTADEIKRIFSGEIK
FT                   TWKQLDPGLSDTPIVIAVRDLGGGASQVFDELVMKGTPVAKEALQLPSMGALAGKVMEN
FT                   ANAIGYVSVGLVTQNQNKLAVLKVDGIEPTVENIALGKYKIARPLLLLTKDKPDARQQL
FT                   FIDYLLSADGLKIVEDMGFIPPASRQ"
     MKKRSFLSII SLLLGLFLLA GCSQNQQAQT EQIKDTEGQA YSIKIGGSST LSPVIAKCAD        60
     NFTEKYKTWN KIDPKLPEEA ITIFVSSGGS GFGVKSTING TVDIGLASRE ITNSEKEKMA       120
     KGNIFKMGSD ALTIAVNPQN PVLKVKPNLT ADEIKRIFSG EIKTWKQLDP GLSDTPIVIA       180
     VRDLGGGASQ VFDELVMKGT PVAKEALQLP SMGALAGKVM ENANAIGYVS VGLVTQNQNK       240
     LAVLKVDGIE PTVENIALGK YKIARPLLLL TKDKPDARQQ LFIDYLLSAD GLKIVEDMGF       300
     IPPASRQ                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page