(data stored in ACNUC7421 zone)

EMBL: CP001720.PE128

CP001720.PE128       Location/Qualifiers
FT   CDS             141455..142699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0130"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="PFAM: copper amine oxidase domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61093"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T7"
FT                   /inference="protein motif:PFAM:PF07833"
FT                   /protein_id="ACV61093.1"
FT                   /translation="MTIDTTFNKFIGTLILFLSFAVISFNTAYASGKFTVGSNSYTIDQ
FT                   QVNYMDVSPYIKDNRTYLPVRFAAIAAGVSNDNIMWNDEAQTVVIVKGNQVVQFSVGNK
FT                   VMLINGVKKHMDVSPEVMEGRVMIPLRFLAEALGADVNWDASTQTITISGMMQHLQQST
FT                   NSTYLPVSIEVPAIQNELPANTVSKDFEWKYNDITYTWHVVVPTELLDWDRKINNIVDG
FT                   FYSSNAYEQAATLKSMEKNIKDLILSTSLESNNNLTPWVNEPKNYKWAGYHANSLSAIA
FT                   QSNSYDYFHTAEFVQSFVGAIPYNITDKPQLPAQTIVDNGDCKDKSILLASMLKNMGYQ
FT                   VALLIFYPTSEEAGGHMAVGIVFNDDQIPTDRELTYYLYDGIKYYFAETTTPNWLIGQI
FT                   SDEAKEKQAYVYPVN"
     MTIDTTFNKF IGTLILFLSF AVISFNTAYA SGKFTVGSNS YTIDQQVNYM DVSPYIKDNR        60
     TYLPVRFAAI AAGVSNDNIM WNDEAQTVVI VKGNQVVQFS VGNKVMLING VKKHMDVSPE       120
     VMEGRVMIPL RFLAEALGAD VNWDASTQTI TISGMMQHLQ QSTNSTYLPV SIEVPAIQNE       180
     LPANTVSKDF EWKYNDITYT WHVVVPTELL DWDRKINNIV DGFYSSNAYE QAATLKSMEK       240
     NIKDLILSTS LESNNNLTPW VNEPKNYKWA GYHANSLSAI AQSNSYDYFH TAEFVQSFVG       300
     AIPYNITDKP QLPAQTIVDN GDCKDKSILL ASMLKNMGYQ VALLIFYPTS EEAGGHMAVG       360
     IVFNDDQIPT DRELTYYLYD GIKYYFAETT TPNWLIGQIS DEAKEKQAYV YPVN             414
//

If you have problems or comments...

PBIL Back to PBIL home page