(data stored in ACNUC7421 zone)

EMBL: CP001720.PE13

CP001720.PE13        Location/Qualifiers
FT   CDS             16965..17210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60978"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV60978.1"
FT                   /translation="MDIKKYSEEVIDLLNNLSDEEFDMLLIDAGIVEVDECPFVMDTSL
FT                   KISLSMSVSYKEAAGIYSHSITDANKNNFVVDLKVA"
     MDIKKYSEEV IDLLNNLSDE EFDMLLIDAG IVEVDECPFV MDTSLKISLS MSVSYKEAAG        60
     IYSHSITDAN KNNFVVDLKV A                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page