(data stored in ACNUC7421 zone)

EMBL: CP001720.PE131

CP001720.PE131       Location/Qualifiers
FT   CDS             complement(151802..153109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0134"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: eba:ebA6749 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61096"
FT                   /db_xref="GOA:C8W2U0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U0"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACV61096.1"
FT                   /translation="MPESKTQKPKKQKAKKLVEPIEIDNDALYENCAGLDVHQETVVIC
FT                   VLFGSIDKRPKKVVETFKTTTSGLLDLADFLLSYNVTHVAMESTSVYWKPVWNVLENTF
FT                   SLILANARTIKNVPGRKTDVKDASWIAKLLRNGLIEGSFVPPLPIRDLRDLTRYKRKLL
FT                   NDLVAEKNRIHKTLQDANIKLTTYISDIFGVSRRNLLEAIICGQVIKPADLDVLIKGKL
FT                   RKKIPEIVDALNGRLRLHHREMLLYSWDHILYIEKVIANIEVKIQQELVIYQEAIELIK
FT                   SLSLIKDTTAAVIIVEIGVDMTVFHSDKHISSWAGLSPGNNESAGKRKSSRTTQGNTAL
FT                   KSILCQCAWAASRQRDSRLNALFWRITKNQGKKKAVIATAHEILVIVYHMLSRGVPYNE
FT                   LGRDYLGKHINNQESKAVKYLTQKGYIIQPPEGECA"
     MPESKTQKPK KQKAKKLVEP IEIDNDALYE NCAGLDVHQE TVVICVLFGS IDKRPKKVVE        60
     TFKTTTSGLL DLADFLLSYN VTHVAMESTS VYWKPVWNVL ENTFSLILAN ARTIKNVPGR       120
     KTDVKDASWI AKLLRNGLIE GSFVPPLPIR DLRDLTRYKR KLLNDLVAEK NRIHKTLQDA       180
     NIKLTTYISD IFGVSRRNLL EAIICGQVIK PADLDVLIKG KLRKKIPEIV DALNGRLRLH       240
     HREMLLYSWD HILYIEKVIA NIEVKIQQEL VIYQEAIELI KSLSLIKDTT AAVIIVEIGV       300
     DMTVFHSDKH ISSWAGLSPG NNESAGKRKS SRTTQGNTAL KSILCQCAWA ASRQRDSRLN       360
     ALFWRITKNQ GKKKAVIATA HEILVIVYHM LSRGVPYNEL GRDYLGKHIN NQESKAVKYL       420
     TQKGYIIQPP EGECA                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page