(data stored in ACNUC7421 zone)

EMBL: CP001720.PE132

CP001720.PE132       Location/Qualifiers
FT   CDS             153332..154465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61097"
FT                   /db_xref="GOA:C8W2U1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U1"
FT                   /inference="similar to AA sequence:KEGG:Sfum_2747"
FT                   /protein_id="ACV61097.1"
FT                   /translation="MPFESRRPQLQLTSEEVNNLEKIIHSRTEGISRVERAKIFLLYHQ
FT                   GETVSSIARKLKTNRSKVERHINKALEFGIEIALNDLPRPGKPETITVEAKTWLISLAC
FT                   QKPKDLGYSYELWTTALLSKHVREHCEEQGHPSLKNLSRGTVSKILSANQVKPHKIKYY
FT                   LERRDPEFEQKMANVLYVYKEVEIVSEKASGSIYAFLSYDEKPGIQAIENKAPDIPPSP
FT                   GKYPCIGRDYEYVRHGTVSLMAGIDLITGHIIATVEDRHRSSEFVEFLKLTDEHYKDKE
FT                   KIKIILDNHSAHISKETRVYLNTVPNRFEFVFTPKHGSWLNLIESFFGKMAQSMLRAIR
FT                   VKSKEELKERIYTYIKEINDCPTVYRWKYKMDELTII"
     MPFESRRPQL QLTSEEVNNL EKIIHSRTEG ISRVERAKIF LLYHQGETVS SIARKLKTNR        60
     SKVERHINKA LEFGIEIALN DLPRPGKPET ITVEAKTWLI SLACQKPKDL GYSYELWTTA       120
     LLSKHVREHC EEQGHPSLKN LSRGTVSKIL SANQVKPHKI KYYLERRDPE FEQKMANVLY       180
     VYKEVEIVSE KASGSIYAFL SYDEKPGIQA IENKAPDIPP SPGKYPCIGR DYEYVRHGTV       240
     SLMAGIDLIT GHIIATVEDR HRSSEFVEFL KLTDEHYKDK EKIKIILDNH SAHISKETRV       300
     YLNTVPNRFE FVFTPKHGSW LNLIESFFGK MAQSMLRAIR VKSKEELKER IYTYIKEIND       360
     CPTVYRWKYK MDELTII                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page