(data stored in ACNUC7421 zone)

EMBL: CP001720.PE134

CP001720.PE134       Location/Qualifiers
FT   CDS             156836..157414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61099"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61099.1"
FT                   /translation="MIVNGTTYTESFYFHHDGTITGLYITFFTNNGHHLVPATIEDLGG
FT                   GLKRASATYTTVMNDNCIRAVDIFQPSGTWTYIEIARAQLEAKAYATSYQINGASHAAE
FT                   DFNIPTVGILNKDKGAIEIRFNPLTINNWNSYFYMDISTGRFLLFFDNTGRVLWDYGAV
FT                   NDSISSVAGIAVAHQPIYICMSCFGLVLG"
     MIVNGTTYTE SFYFHHDGTI TGLYITFFTN NGHHLVPATI EDLGGGLKRA SATYTTVMND        60
     NCIRAVDIFQ PSGTWTYIEI ARAQLEAKAY ATSYQINGAS HAAEDFNIPT VGILNKDKGA       120
     IEIRFNPLTI NNWNSYFYMD ISTGRFLLFF DNTGRVLWDY GAVNDSISSV AGIAVAHQPI       180
     YICMSCFGLV LG                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page