(data stored in ACNUC7421 zone)

EMBL: CP001720.PE136

CP001720.PE136       Location/Qualifiers
FT   CDS             157779..158117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: avi:Avi_3476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61101"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61101.1"
FT                   /translation="MNIQCTWRLATESSIMVASGDFYLTRTGISDDDDFVWDKLGENRF
FT                   DEKVNEFKKRLKTNIIVTEISADIFGGLKMCLDSGISLELFPDDSMEDEFWRFIVFEGK
FT                   NKHFVVFE"
     MNIQCTWRLA TESSIMVASG DFYLTRTGIS DDDDFVWDKL GENRFDEKVN EFKKRLKTNI        60
     IVTEISADIF GGLKMCLDSG ISLELFPDDS MEDEFWRFIV FEGKNKHFVV FE               112
//

If you have problems or comments...

PBIL Back to PBIL home page