(data stored in ACNUC7421 zone)

EMBL: CP001720.PE137

CP001720.PE137       Location/Qualifiers
FT   CDS             158796..159383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61102"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61102.1"
FT                   /translation="MFYELEKDDKYPSVWYSDSDDFDPFISIKCPKYPGHQRGVRDINV
FT                   NLWIDIKKPKMGDFVSTVYSDWLITDHVAEIFKANNLTGYRLQPVKVCNKKLDFNLWEL
FT                   IITGSAGKAHPDSGIYVKEHCEYCGSMIYSPIKKGIGIIVDEARWDGSDFFTITEYYKY
FT                   VFITEKVKKIIEENNLRGVRLVWPSELGFDES"
     MFYELEKDDK YPSVWYSDSD DFDPFISIKC PKYPGHQRGV RDINVNLWID IKKPKMGDFV        60
     STVYSDWLIT DHVAEIFKAN NLTGYRLQPV KVCNKKLDFN LWELIITGSA GKAHPDSGIY       120
     VKEHCEYCGS MIYSPIKKGI GIIVDEARWD GSDFFTITEY YKYVFITEKV KKIIEENNLR       180
     GVRLVWPSEL GFDES                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page