(data stored in ACNUC7421 zone)

EMBL: CP001720.PE138

CP001720.PE138       Location/Qualifiers
FT   CDS             161366..161986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61103"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61103.1"
FT                   /translation="MNFYVVNMHLFDDKKYAYGEQVDQKTGDYEKCKICGSPISMRKWL
FT                   PPLKAKLSKPSYGDFVFGTFTTFLVTERFKKEYEATGLTGIVSFEPVEIVKVSRKRDSS
FT                   PETPSYYYVSIARSKAVIDEKKSKIRRDGEISCNHCRTGGIIKSLKGIFFEDNTWSGED
FT                   IFFPVGLPGTIVVSERFADFARDYGFSNINFIPAEEYIPPWVK"
     MNFYVVNMHL FDDKKYAYGE QVDQKTGDYE KCKICGSPIS MRKWLPPLKA KLSKPSYGDF        60
     VFGTFTTFLV TERFKKEYEA TGLTGIVSFE PVEIVKVSRK RDSSPETPSY YYVSIARSKA       120
     VIDEKKSKIR RDGEISCNHC RTGGIIKSLK GIFFEDNTWS GEDIFFPVGL PGTIVVSERF       180
     ADFARDYGFS NINFIPAEEY IPPWVK                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page