(data stored in ACNUC7421 zone)

EMBL: CP001720.PE14

CP001720.PE14        Location/Qualifiers
FT   CDS             17213..17644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: glo:Glov_3490 protein export chaperone SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60979"
FT                   /db_xref="GOA:C8VVB0"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV60979.1"
FT                   /translation="MDNQLVSVFKFIDYKVDYINFKLNSGFTFEEPIDIDFDLRVEMAF
FT                   NSEKPKGKITINAIVFDNAEENRFPFFLDIAVTGLFAGEDGMPIEEFRKYCETSGTAAM
FT                   FPFLRSAIADITRTANIESLILPIINIRNLMKKDVESKT"
     MDNQLVSVFK FIDYKVDYIN FKLNSGFTFE EPIDIDFDLR VEMAFNSEKP KGKITINAIV        60
     FDNAEENRFP FFLDIAVTGL FAGEDGMPIE EFRKYCETSG TAAMFPFLRS AIADITRTAN       120
     IESLILPIIN IRNLMKKDVE SKT                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page