(data stored in ACNUC7421 zone)

EMBL: CP001720.PE142

CP001720.PE142       Location/Qualifiers
FT   CDS             join(167166..167684,167683..168216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Dtox_0149"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /note="KEGG: bha:BH2521 transposase (21)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61107"
FT                   /db_xref="GOA:C8W2V1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V1"
FT                   /inference="protein motif:COG:COG3415"
FT                   /protein_id="ACV61107.1"
FT                   /translation="MRKLHLNNPQNLTIEDLNKIKRETPYKLRCRVQAVILVMKGRQAK
FT                   QIAEYLDISEQTIRKYVAYFNEGGVEKLLHVSKKPGRPPRLTNEQKEEVKEVLKQSPSE
FT                   VGFSTHTTWNCKTLAAYIHDTYGVKYTSDGVWRMLLKMDFRYNRPTYVLAKADPEKQKA
FT                   FQDELEELKKNLTECEILLYVDASHIRDYQGLQRAWFPKGEQKKIKTYGHHAKVTLYGA
FT                   LNYYTGKVFCVNYDKIDAEKFKDFLKKLVSHFLKDDISKIYIVLDNARVHHAKLLKDFL
FT                   DEHKDHLFLKFLPPYSPNLNCIEELWKWLKNTAIYNRFHKNASEIQKSVDSFLEEIKCC
FT                   SEDVKKRLCV"
     MRKLHLNNPQ NLTIEDLNKI KRETPYKLRC RVQAVILVMK GRQAKQIAEY LDISEQTIRK        60
     YVAYFNEGGV EKLLHVSKKP GRPPRLTNEQ KEEVKEVLKQ SPSEVGFSTH TTWNCKTLAA       120
     YIHDTYGVKY TSDGVWRMLL KMDFRYNRPT YVLAKADPEK QKAFQDELEE LKKNLTECEI       180
     LLYVDASHIR DYQGLQRAWF PKGEQKKIKT YGHHAKVTLY GALNYYTGKV FCVNYDKIDA       240
     EKFKDFLKKL VSHFLKDDIS KIYIVLDNAR VHHAKLLKDF LDEHKDHLFL KFLPPYSPNL       300
     NCIEELWKWL KNTAIYNRFH KNASEIQKSV DSFLEEIKCC SEDVKKRLCV                  350
//

If you have problems or comments...

PBIL Back to PBIL home page