(data stored in ACNUC7421 zone)

EMBL: CP001720.PE146

CP001720.PE146       Location/Qualifiers
FT   CDS             170739..171242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61111"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61111.1"
FT                   /translation="MKEYFPFIFIIHSIKYYCIWYSNERDGFITESNKIRYFDNMENLF
FT                   TYATSNNIKIEERKTILSIDKALTWLQQNKKEIDCTYFLDYWNIISDLANSLDTKFYGN
FT                   QDNNIINLIYDKLFYGNNLTALKHDGETFTPDWTAEEVNELIEVIKDGIRVVGFQFEAM
FT                   SVNL"
     MKEYFPFIFI IHSIKYYCIW YSNERDGFIT ESNKIRYFDN MENLFTYATS NNIKIEERKT        60
     ILSIDKALTW LQQNKKEIDC TYFLDYWNII SDLANSLDTK FYGNQDNNII NLIYDKLFYG       120
     NNLTALKHDG ETFTPDWTAE EVNELIEVIK DGIRVVGFQF EAMSVNL                     167
//

If you have problems or comments...

PBIL Back to PBIL home page