(data stored in ACNUC7421 zone)

EMBL: CP001720.PE148

CP001720.PE148       Location/Qualifiers
FT   CDS             173893..174144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0788 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61113"
FT                   /db_xref="GOA:C8W2V7"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61113.1"
FT                   /translation="MTKFSKLYTKIVRNPKDVEFDELDKILKKYNFKRRQPSKGSSHYT
FT                   YFHDKIDDIVTVPKDKPIKSIYVKIAIAAIEKLRKEDK"
     MTKFSKLYTK IVRNPKDVEF DELDKILKKY NFKRRQPSKG SSHYTYFHDK IDDIVTVPKD        60
     KPIKSIYVKI AIAAIEKLRK EDK                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page