(data stored in ACNUC7421 zone)

EMBL: CP001720.PE149

CP001720.PE149       Location/Qualifiers
FT   CDS             174146..174511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0158"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150; HicB
FT                   family protein; KEGG: noc:Noc_2743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61114"
FT                   /db_xref="GOA:C8W2V8"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V8"
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /protein_id="ACV61114.1"
FT                   /translation="MKNMEYYLKLNYDIKLRKLTKDEGEGWLAQIPLLPGCMSDGNTPV
FT                   EALTNIEDAKKSWIETCLELGRPVPEPITDEHSGQLRIRIPKTLHRILAERAKEENISL
FT                   NQYINYQLSRGVGYTPK"
     MKNMEYYLKL NYDIKLRKLT KDEGEGWLAQ IPLLPGCMSD GNTPVEALTN IEDAKKSWIE        60
     TCLELGRPVP EPITDEHSGQ LRIRIPKTLH RILAERAKEE NISLNQYINY QLSRGVGYTP       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page