(data stored in ACNUC7421 zone)

EMBL: CP001720.PE156

CP001720.PE156       Location/Qualifiers
FT   CDS             188008..188238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0166"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: dat:HRM2_06850 TatA"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61121"
FT                   /db_xref="GOA:C8W2W5"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2W5"
FT                   /inference="protein motif:TFAM:TIGR01411"
FT                   /protein_id="ACV61121.1"
FT                   /translation="MFGGLFQPTHLILILVVVLIIFGPGKLPEVGKAIGKGIREIKKAA
FT                   SDETNENKTELAQQEEKSSNVVAIAKSSDSK"
     MFGGLFQPTH LILILVVVLI IFGPGKLPEV GKAIGKGIRE IKKAASDETN ENKTELAQQE        60
     EKSSNVVAIA KSSDSK                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page