(data stored in ACNUC7421 zone)

EMBL: CP001720.PE158

CP001720.PE158       Location/Qualifiers
FT   CDS             189116..190657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0168"
FT                   /product="hydrogenase, Fe-only"
FT                   /EC_number="1.12.7.2"
FT                   /note="KEGG: sat:SYN_01370 iron only hydrogenase large
FT                   subunit; TIGRFAM: hydrogenase, Fe-only; PFAM: hydrogenase
FT                   large subunit domain protein; iron hydrogenase small
FT                   subunit; 4Fe-4S ferredoxin iron- sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61123"
FT                   /db_xref="GOA:C8W2W7"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2W7"
FT                   /inference="protein motif:TFAM:TIGR02512"
FT                   /protein_id="ACV61123.1"
FT                   /translation="MDDRFSLEKEITRRSFLKMMGGLGLTGLSLSLAGCGEGQQEFAGG
FT                   KGWMPQQYQVAGAWPAQVRGRVPVSPDNPSIARDDRKCILCGQCLEVCKNTQTVYGHYA
FT                   LPLVNDIVCVNCGQCALWCPTGAISECDDSEKVWEAIQDPGKVVVVQTAPATRVALGEE
FT                   FGLEPGAWVMGQQVAALRRLGFDVIFDTNFTADLTIMEEATELIRRVKGDLKKPLPQFT
FT                   SCCPGWIKFCEYFYPDLFLNLSTCKSPQQMLGALVKTYFAKEKGLNPKNIFSVAIMPCT
FT                   AKKFEANRSEMKDSGYRDVDSVLTTRELSRLLKKHNIDLTKLPAENYDPLMGKSTGGAV
FT                   IFGATGGVMEAAVRTAYFFITQSPPPSGLLQLTPVRGLAGVKEAAVEIPGVGRIRVAVC
FT                   HGMGNAREILEATRKGNAPWHFVEFMCCPGGCQSGGGQPRTAVPPSDEIRLKRIASLYN
FT                   ADAKMVMRESHENPDILTIYQKFLEHPMSELAERLLHTEYISRGKCFSPLKSGAV"
     MDDRFSLEKE ITRRSFLKMM GGLGLTGLSL SLAGCGEGQQ EFAGGKGWMP QQYQVAGAWP        60
     AQVRGRVPVS PDNPSIARDD RKCILCGQCL EVCKNTQTVY GHYALPLVND IVCVNCGQCA       120
     LWCPTGAISE CDDSEKVWEA IQDPGKVVVV QTAPATRVAL GEEFGLEPGA WVMGQQVAAL       180
     RRLGFDVIFD TNFTADLTIM EEATELIRRV KGDLKKPLPQ FTSCCPGWIK FCEYFYPDLF       240
     LNLSTCKSPQ QMLGALVKTY FAKEKGLNPK NIFSVAIMPC TAKKFEANRS EMKDSGYRDV       300
     DSVLTTRELS RLLKKHNIDL TKLPAENYDP LMGKSTGGAV IFGATGGVME AAVRTAYFFI       360
     TQSPPPSGLL QLTPVRGLAG VKEAAVEIPG VGRIRVAVCH GMGNAREILE ATRKGNAPWH       420
     FVEFMCCPGG CQSGGGQPRT AVPPSDEIRL KRIASLYNAD AKMVMRESHE NPDILTIYQK       480
     FLEHPMSELA ERLLHTEYIS RGKCFSPLKS GAV                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page