(data stored in ACNUC7421 zone)

EMBL: CP001720.PE160

CP001720.PE160       Location/Qualifiers
FT   CDS             191492..192628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0170"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   sus:Acid_4205 polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61125"
FT                   /db_xref="GOA:C8W2W9"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2W9"
FT                   /inference="protein motif:PFAM:PF03916"
FT                   /protein_id="ACV61125.1"
FT                   /translation="MQKKWHFRMTPVRAVLLCLSLLAVVLAVYRLVFGLGSATNLNDRW
FT                   PWGLWIGFDVLTGVALAGGGYSTCLLVHVLRINKFKPIVRSAMLTSLIGYLLVMGGLFL
FT                   DIGRWFNFWAPFVSWGYHSVLFEVFWCVSIYTLIQTLEFGEIATEKVGRSWHGFFKKIM
FT                   PVLFIVGIVLPTLHQSSLGSLYVIEVGKLYPLWWSMLLPLFFLMSSFFVGPAMVVVETT
FT                   LAGKAHGHQVETSVLQSLVKVSGSVMLVYLILKIADLFYRHKAGLVLAGNFEGYMFLLE
FT                   MLAGIIIPLIICFTPGLRSTKGGLLAFSLLVVAGVIINRMNVVFTGMSRYMGGSYFPSF
FT                   IEWAVSIGLISAGVLAYLFIVENFNILSEEPRVKEIAH"
     MQKKWHFRMT PVRAVLLCLS LLAVVLAVYR LVFGLGSATN LNDRWPWGLW IGFDVLTGVA        60
     LAGGGYSTCL LVHVLRINKF KPIVRSAMLT SLIGYLLVMG GLFLDIGRWF NFWAPFVSWG       120
     YHSVLFEVFW CVSIYTLIQT LEFGEIATEK VGRSWHGFFK KIMPVLFIVG IVLPTLHQSS       180
     LGSLYVIEVG KLYPLWWSML LPLFFLMSSF FVGPAMVVVE TTLAGKAHGH QVETSVLQSL       240
     VKVSGSVMLV YLILKIADLF YRHKAGLVLA GNFEGYMFLL EMLAGIIIPL IICFTPGLRS       300
     TKGGLLAFSL LVVAGVIINR MNVVFTGMSR YMGGSYFPSF IEWAVSIGLI SAGVLAYLFI       360
     VENFNILSEE PRVKEIAH                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page