(data stored in ACNUC7421 zone)

EMBL: CP001720.PE162

CP001720.PE162       Location/Qualifiers
FT   CDS             complement(193919..195640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0172"
FT                   /product="hydrogenase, Fe-only"
FT                   /note="TIGRFAM: hydrogenase, Fe-only; PFAM: hydrogenase
FT                   large subunit domain protein; iron hydrogenase small
FT                   subunit; ferredoxin; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; KEGG: sfu:Sfum_0844 hydrogenases, Fe-only"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61127"
FT                   /db_xref="GOA:C8W2X1"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X1"
FT                   /inference="protein motif:TFAM:TIGR02512"
FT                   /protein_id="ACV61127.1"
FT                   /translation="MSQITLTIDGQQVQARAGTTVLEAARKIGIRIPTLCYLKEVNEAG
FT                   ACRVCLVEVQGARTLQASCVTPVAEGMVVKTNTPEVRQARKLNLELIMSNHPQECLICP
FT                   RSTNCELQAVAAELGLKELRFEGTNRHYQPDNSSPSLVRDPRKCILCRRCVSVCENIQK
FT                   VTAIAPQERGFDTVIAPAFLASLSDSTCVNCGQCALVCPTAAIVEKNQVQEVWSALADP
FT                   AKHVVVQTAPATRISVGEIFGLEPGSLVTGKMVAALRRLGFDKVFDTDFTADLTIMEEG
FT                   SELIRRLNGKGALPLITSCSPGWIKFIEHHYPDLLPHLSTCKSPQQMFGALAKTYYAEK
FT                   AGLDPGSIFVVSIMPCTAKKYEAGRPEMNSSGYQDVDVVLTTRELGKMLKEAGIDFTAL
FT                   PEENYDQPLGISTGAGVIFGATGGVMEAALRTGYELVTGETLASIEFKDVRGMEGVKEA
FT                   AIDLKGTILNVAVAHGLGNARELLEKIRNGDIYHFIEIMCCPGGCIGGGGQPIPTDQET
FT                   RLKRAAGIYSTDQSMPLRKSHENPAVQSLYKEFLGEPLGHKSHQLLHTVYTERSKF"
     MSQITLTIDG QQVQARAGTT VLEAARKIGI RIPTLCYLKE VNEAGACRVC LVEVQGARTL        60
     QASCVTPVAE GMVVKTNTPE VRQARKLNLE LIMSNHPQEC LICPRSTNCE LQAVAAELGL       120
     KELRFEGTNR HYQPDNSSPS LVRDPRKCIL CRRCVSVCEN IQKVTAIAPQ ERGFDTVIAP       180
     AFLASLSDST CVNCGQCALV CPTAAIVEKN QVQEVWSALA DPAKHVVVQT APATRISVGE       240
     IFGLEPGSLV TGKMVAALRR LGFDKVFDTD FTADLTIMEE GSELIRRLNG KGALPLITSC       300
     SPGWIKFIEH HYPDLLPHLS TCKSPQQMFG ALAKTYYAEK AGLDPGSIFV VSIMPCTAKK       360
     YEAGRPEMNS SGYQDVDVVL TTRELGKMLK EAGIDFTALP EENYDQPLGI STGAGVIFGA       420
     TGGVMEAALR TGYELVTGET LASIEFKDVR GMEGVKEAAI DLKGTILNVA VAHGLGNARE       480
     LLEKIRNGDI YHFIEIMCCP GGCIGGGGQP IPTDQETRLK RAAGIYSTDQ SMPLRKSHEN       540
     PAVQSLYKEF LGEPLGHKSH QLLHTVYTER SKF                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page