(data stored in ACNUC7421 zone)

EMBL: CP001720.PE164

CP001720.PE164       Location/Qualifiers
FT   CDS             complement(197471..197830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0174"
FT                   /product="NADP-reducing hydrogenase, subunit B"
FT                   /note="KEGG: dat:HRM2_16520 NADP-reducing hydrogenase,
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61129"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X3"
FT                   /inference="similar to AA sequence:KEGG:HRM2_16520"
FT                   /protein_id="ACV61129.1"
FT                   /translation="MRTLEDLNKLRDKLQAEISIRERKQEITVNVSMGTCGIAAGARET
FT                   MKTLIEEISSKNIKDIALTQTGCLGACQQEPLVQIQKGGEKVTYINVDQEKARQIVNRH
FT                   LLEGKVIEQWTKPEE"
     MRTLEDLNKL RDKLQAEISI RERKQEITVN VSMGTCGIAA GARETMKTLI EEISSKNIKD        60
     IALTQTGCLG ACQQEPLVQI QKGGEKVTYI NVDQEKARQI VNRHLLEGKV IEQWTKPEE        119
//

If you have problems or comments...

PBIL Back to PBIL home page