(data stored in ACNUC7421 zone)

EMBL: CP001720.PE166

CP001720.PE166       Location/Qualifiers
FT   CDS             complement(198388..198885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0176"
FT                   /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone) 24 kDa
FT                   subunit; KEGG: sfu:Sfum_0846 NADH dehydrogenase
FT                   (ubiquinone), 24 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61131"
FT                   /db_xref="GOA:C8W2X5"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR028431"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X5"
FT                   /inference="protein motif:PFAM:PF01257"
FT                   /protein_id="ACV61131.1"
FT                   /translation="MGDKCKCHSQLSAELLSQVDKIIEPSSGRSGNLIQVLHRVQELVG
FT                   YLPREVQVRVAEGLNVPLSIVYGVVSFYSFFNVLPKGKHTINVCTGTACYVRGAKQLIN
FT                   NIQDQLDIKTGGTTSDGQFSLGMVRCVGACGLGPVVTINEDVHAQVRPEKIDGILAKYS
FT                   KE"
     MGDKCKCHSQ LSAELLSQVD KIIEPSSGRS GNLIQVLHRV QELVGYLPRE VQVRVAEGLN        60
     VPLSIVYGVV SFYSFFNVLP KGKHTINVCT GTACYVRGAK QLINNIQDQL DIKTGGTTSD       120
     GQFSLGMVRC VGACGLGPVV TINEDVHAQV RPEKIDGILA KYSKE                       165
//

If you have problems or comments...

PBIL Back to PBIL home page