(data stored in ACNUC7421 zone)

EMBL: CP001720.PE167

CP001720.PE167       Location/Qualifiers
FT   CDS             complement(198993..199343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0177"
FT                   /product="iron-sulfur binding hydrogenase"
FT                   /note="KEGG: dat:HRM2_16550 iron-sulfur binding
FT                   hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61132"
FT                   /db_xref="GOA:C8W2X6"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X6"
FT                   /inference="similar to AA sequence:KEGG:HRM2_16550"
FT                   /protein_id="ACV61132.1"
FT                   /translation="MEQWSKIIKFLHLTLLTDPAFLKREIRGAYCGDLLSDVLANSLSG
FT                   NIWITIHRHRNVIAVASLLNLCGVIITGNRQPDRETLAAAEMEGVPIFTTPLNNFAAAG
FT                   RLYHLLELKLTD"
     MEQWSKIIKF LHLTLLTDPA FLKREIRGAY CGDLLSDVLA NSLSGNIWIT IHRHRNVIAV        60
     ASLLNLCGVI ITGNRQPDRE TLAAAEMEGV PIFTTPLNNF AAAGRLYHLL ELKLTD           116
//

If you have problems or comments...

PBIL Back to PBIL home page