(data stored in ACNUC7421 zone)

EMBL: CP001720.PE168

CP001720.PE168       Location/Qualifiers
FT   CDS             complement(199343..200674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0178"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; Fe-S cluster domain protein; KEGG: dat:HRM2_16550
FT                   iron-sulfur binding hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61133"
FT                   /db_xref="GOA:C8W2X7"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X7"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV61133.1"
FT                   /translation="MQKYFHSVRLDEDKCKGCTNCVKRCPTEAIRVREGRALIIEERCI
FT                   DCGECIKICPNRAKLATTDGLEQLQNFHYTIALPAPSLYAQFEPNTSPEQILGALLNIG
FT                   FDDIFEVALGAEAVSLALRDYLSRDHPRPMISSACPAVLRLMQVRFPGLLQHIVPIETP
FT                   MEISAGLAREKARQQHGFSDNQIGVFFITPCPAKVTAIKQPFGEKSYVDGAISMSVIYG
FT                   ELLHSLDSPSTKQLPLLSGARGVGWGKAGGENHAIRCHSHLAVDGIHSIINVLEEIERG
FT                   GLSDIDYLEAQACTGGCIGGPLAPQNLFVARVRMDNLVKKLSLQPDRPKSLSTDPEFLR
FT                   LNKPILPRPALKLDQDINRAIEMLEEVEKITEDLPGLDCGSCGSPNCRALAEDIVRGYA
FT                   DTSFCIFKLRQRLQILAREIVDLSHKQPPAMGREREKELKEGDA"
     MQKYFHSVRL DEDKCKGCTN CVKRCPTEAI RVREGRALII EERCIDCGEC IKICPNRAKL        60
     ATTDGLEQLQ NFHYTIALPA PSLYAQFEPN TSPEQILGAL LNIGFDDIFE VALGAEAVSL       120
     ALRDYLSRDH PRPMISSACP AVLRLMQVRF PGLLQHIVPI ETPMEISAGL AREKARQQHG       180
     FSDNQIGVFF ITPCPAKVTA IKQPFGEKSY VDGAISMSVI YGELLHSLDS PSTKQLPLLS       240
     GARGVGWGKA GGENHAIRCH SHLAVDGIHS IINVLEEIER GGLSDIDYLE AQACTGGCIG       300
     GPLAPQNLFV ARVRMDNLVK KLSLQPDRPK SLSTDPEFLR LNKPILPRPA LKLDQDINRA       360
     IEMLEEVEKI TEDLPGLDCG SCGSPNCRAL AEDIVRGYAD TSFCIFKLRQ RLQILAREIV       420
     DLSHKQPPAM GREREKELKE GDA                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page