(data stored in ACNUC7421 zone)

EMBL: CP001720.PE169

CP001720.PE169       Location/Qualifiers
FT   CDS             complement(200674..201102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0179"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: dat:HRM2_16560 RsbW2"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61134"
FT                   /db_xref="GOA:C8W2X8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV61134.1"
FT                   /translation="MQLEFEIKGMDFARAGEAAAKIKKALQMVGMEVETIRKTLVVAYE
FT                   AELNVVIHAYAGTLTAKISPDAVEIKVMDEGPGIADIELAMQEGYSTAPSNIREMGFGA
FT                   GMGLPNIERCSDQMELTSEVNQGTLLTAIIFNRTSGEK"
     MQLEFEIKGM DFARAGEAAA KIKKALQMVG MEVETIRKTL VVAYEAELNV VIHAYAGTLT        60
     AKISPDAVEI KVMDEGPGIA DIELAMQEGY STAPSNIREM GFGAGMGLPN IERCSDQMEL       120
     TSEVNQGTLL TAIIFNRTSG EK                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page