(data stored in ACNUC7421 zone)

EMBL: CP001720.PE172

CP001720.PE172       Location/Qualifiers
FT   CDS             202967..204376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0182"
FT                   /product="biotin and thiamin synthesis associated"
FT                   /note="PFAM: biotin and thiamin synthesis associated;
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; KEGG: sfu:Sfum_0842 thiamine biosynthesis
FT                   protein ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61137"
FT                   /db_xref="GOA:C8W2Y1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024007"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Y1"
FT                   /inference="protein motif:PFAM:PF06968"
FT                   /protein_id="ACV61137.1"
FT                   /translation="MTVAAADFIDDQKIWGLLEEAKNADNKKVKEIIEKAVKARGLTPG
FT                   EAAVLLHLEDAALLEEMYAAANKIKESIYGRRLVLFAPLYISNYCVNSCVYCGYRTHSK
FT                   IFRRKLTMDEIKEEVKVLEGLGHKRLALEFGEHPVECPIDYVLEAIRTIYSVKEKNGSI
FT                   RRVNVNIAATTVEEYRLLKEAGIGTYILFQETYHRQTYSRMHPAGPKRDYVWHTTAMDR
FT                   AMQGGIDDVGVGVLFGLYDYKYEVMGLLMHALHLEEAFGVGPHTISVPRLKPAAGMDLE
FT                   QFPHLVSDRDFKKLIAVLRLAVPYTGMILSTREGADFRDELLSIGISQISAGSCTGVGG
FT                   YRSQYRQGAGKEEDTRQFNVEDNRSPDEVIRSIAESGYIPSFCTACYRQGRTGDRFMAL
FT                   AKTGEIQNVCQPNAILTFQEFLLDYAAPETRIAGDNFIKEQINQIPDGIIRRKTEEKLE
FT                   KIKQGWRDLYF"
     MTVAAADFID DQKIWGLLEE AKNADNKKVK EIIEKAVKAR GLTPGEAAVL LHLEDAALLE        60
     EMYAAANKIK ESIYGRRLVL FAPLYISNYC VNSCVYCGYR THSKIFRRKL TMDEIKEEVK       120
     VLEGLGHKRL ALEFGEHPVE CPIDYVLEAI RTIYSVKEKN GSIRRVNVNI AATTVEEYRL       180
     LKEAGIGTYI LFQETYHRQT YSRMHPAGPK RDYVWHTTAM DRAMQGGIDD VGVGVLFGLY       240
     DYKYEVMGLL MHALHLEEAF GVGPHTISVP RLKPAAGMDL EQFPHLVSDR DFKKLIAVLR       300
     LAVPYTGMIL STREGADFRD ELLSIGISQI SAGSCTGVGG YRSQYRQGAG KEEDTRQFNV       360
     EDNRSPDEVI RSIAESGYIP SFCTACYRQG RTGDRFMALA KTGEIQNVCQ PNAILTFQEF       420
     LLDYAAPETR IAGDNFIKEQ INQIPDGIIR RKTEEKLEKI KQGWRDLYF                   469
//

If you have problems or comments...

PBIL Back to PBIL home page