(data stored in ACNUC7421 zone)

EMBL: CP001720.PE180

CP001720.PE180       Location/Qualifiers
FT   CDS             213082..213474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61145"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Y9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61145.1"
FT                   /translation="MANSETLQEVALVLLGTGIPAIGPKLQNKKDAEDVVRSYVLAIHN
FT                   LIMKAGESPYKVLFQKQEDGRYSVLMDGSGASVKILTNLDELMLRRFRHAFQKNMFILT
FT                   SFCEEANGCLECLALTEGLGAVLYAP"
     MANSETLQEV ALVLLGTGIP AIGPKLQNKK DAEDVVRSYV LAIHNLIMKA GESPYKVLFQ        60
     KQEDGRYSVL MDGSGASVKI LTNLDELMLR RFRHAFQKNM FILTSFCEEA NGCLECLALT       120
     EGLGAVLYAP                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page