(data stored in ACNUC7421 zone)

EMBL: CP001720.PE181

CP001720.PE181       Location/Qualifiers
FT   CDS             213561..215171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0193"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; SMART:
FT                   Peptidoglycan-binding LysM; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61146"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z0"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ACV61146.1"
FT                   /translation="MSKKSGAMRNYMDCNYETEYLKINMIIAEDTKQTIVKGKVSVPDP
FT                   KPDVEQILSVEKSARVRRIEVLPDKVVVHGSLNLQIVYVARKPDQSVHSMHHMLTFTTF
FT                   IDLPGVEPDMDVDVKLEVEDVNVKQRHDCNCDRDFDVVAVIKVDAKATQPEELNVVVKV
FT                   HDNNAIIESERLKVDHLIGNARKQIMVDEVFRIPDPKPDIEQIINVDAEVTITHKKIIR
FT                   NKVMFDGEVHLQVLYVARKPDQPVHELHKVIKFSDFVEVPGAGKHMKVEIKTTVESVNV
FT                   DPVKGNPRRLDAGIVLEVKVNVTDPRTVYVVTDVKDSNCKATKYNLRVDQLVGEASTQV
FT                   VVESTSAPPDPKPCAEKILECRVEHIDIEKVEVLSDKVVIRGTLEVKVIYVAMKPNQSV
FT                   HAMHKKMSFRTFVEVPGARKDMDVSVMPMVEFVKAETRGPKVYCEAVIKILVRVTESMD
FT                   QSVVIALDMSEEPEEEPESPVCKPGDMISYTIKSGDTFYKLAMQYDIPLQDLLDANPNV
FT                   NPNNLRVGQVINIPCVAKG"
     MSKKSGAMRN YMDCNYETEY LKINMIIAED TKQTIVKGKV SVPDPKPDVE QILSVEKSAR        60
     VRRIEVLPDK VVVHGSLNLQ IVYVARKPDQ SVHSMHHMLT FTTFIDLPGV EPDMDVDVKL       120
     EVEDVNVKQR HDCNCDRDFD VVAVIKVDAK ATQPEELNVV VKVHDNNAII ESERLKVDHL       180
     IGNARKQIMV DEVFRIPDPK PDIEQIINVD AEVTITHKKI IRNKVMFDGE VHLQVLYVAR       240
     KPDQPVHELH KVIKFSDFVE VPGAGKHMKV EIKTTVESVN VDPVKGNPRR LDAGIVLEVK       300
     VNVTDPRTVY VVTDVKDSNC KATKYNLRVD QLVGEASTQV VVESTSAPPD PKPCAEKILE       360
     CRVEHIDIEK VEVLSDKVVI RGTLEVKVIY VAMKPNQSVH AMHKKMSFRT FVEVPGARKD       420
     MDVSVMPMVE FVKAETRGPK VYCEAVIKIL VRVTESMDQS VVIALDMSEE PEEEPESPVC       480
     KPGDMISYTI KSGDTFYKLA MQYDIPLQDL LDANPNVNPN NLRVGQVINI PCVAKG           536
//

If you have problems or comments...

PBIL Back to PBIL home page