(data stored in ACNUC7421 zone)

EMBL: CP001720.PE182

CP001720.PE182       Location/Qualifiers
FT   CDS             215587..216327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61147"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61147.1"
FT                   /translation="MLSGQDQLYDMHKTLSRLLDVQSKQGSDQNSLVMLSLVNLMGIID
FT                   ILNKRVQASPAAGVSGNLPLDLSSLQTMLGPLLNIFAKQGQGDCKTQPVERNISPNTDQ
FT                   GCVKNNASMKNSVLESANDQSNKSANQDIKPRVVNPLGGLLNLLGGGGSQPNLVPLLAL
FT                   LGLCGGANQPVLTSLLSLLNNQSNQKADIGALVSLISGLAGSHQAAAQNKVTANKAESP
FT                   SAGEARGEESCREEKNKIIVKKGI"
     MLSGQDQLYD MHKTLSRLLD VQSKQGSDQN SLVMLSLVNL MGIIDILNKR VQASPAAGVS        60
     GNLPLDLSSL QTMLGPLLNI FAKQGQGDCK TQPVERNISP NTDQGCVKNN ASMKNSVLES       120
     ANDQSNKSAN QDIKPRVVNP LGGLLNLLGG GGSQPNLVPL LALLGLCGGA NQPVLTSLLS       180
     LLNNQSNQKA DIGALVSLIS GLAGSHQAAA QNKVTANKAE SPSAGEARGE ESCREEKNKI       240
     IVKKGI                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page