(data stored in ACNUC7421 zone)

EMBL: CP001720.PE185

CP001720.PE185       Location/Qualifiers
FT   CDS             complement(217221..217601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0197"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: bsu:BSU18610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61150"
FT                   /db_xref="GOA:C8W2Z4"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z4"
FT                   /inference="similar to AA sequence:KEGG:BSU18610"
FT                   /protein_id="ACV61150.1"
FT                   /translation="MDHVNTDTQEAAKAARDIKTIIEEVQNSSNKAENIMLLSSDNVSS
FT                   GTKTVNEAGTQFIDIIEHIEKLTQQVLQVAAAAEQMTIGVQNVAAATQQQTASMQEVSS
FT                   SAEDLNLVANELLTMSGQFKMQ"
     MDHVNTDTQE AAKAARDIKT IIEEVQNSSN KAENIMLLSS DNVSSGTKTV NEAGTQFIDI        60
     IEHIEKLTQQ VLQVAAAAEQ MTIGVQNVAA ATQQQTASMQ EVSSSAEDLN LVANELLTMS       120
     GQFKMQ                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page