(data stored in ACNUC7421 zone)

EMBL: CP001720.PE186

CP001720.PE186       Location/Qualifiers
FT   CDS             217746..218192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0198"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   ppd:Ppro_0036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61151"
FT                   /db_xref="GOA:C8W2Z5"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z5"
FT                   /inference="protein motif:PFAM:PF04657"
FT                   /protein_id="ACV61151.1"
FT                   /translation="MSARLVVLLIAASSGLLMALQGSLNASQSKIIGLWETTFIVHLLG
FT                   LVLSALLLFIFKLGSITWANLAQAPWYTYLGGILGVLIIYIVARSMPKVGVAPATTAII
FT                   LGQVFTAGLIDHLGLFGLQKIPFSWLNIVGTFLMAGGAWLILKQ"
     MSARLVVLLI AASSGLLMAL QGSLNASQSK IIGLWETTFI VHLLGLVLSA LLLFIFKLGS        60
     ITWANLAQAP WYTYLGGILG VLIIYIVARS MPKVGVAPAT TAIILGQVFT AGLIDHLGLF       120
     GLQKIPFSWL NIVGTFLMAG GAWLILKQ                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page