(data stored in ACNUC7421 zone)

EMBL: CP001720.PE187

CP001720.PE187       Location/Qualifiers
FT   CDS             complement(218196..218915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0199"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: mca:MCA2417 ZIP zinc
FT                   transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61152"
FT                   /db_xref="GOA:C8W2Z6"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z6"
FT                   /inference="protein motif:PFAM:PF02535"
FT                   /protein_id="ACV61152.1"
FT                   /translation="MAEIMILSLIAGLGTCLGAALVITFGQINSKSLSVFLGLACGVMI
FT                   AVILFDLLPAAYFYGNIFSCLGGFCGGLLLLLLLELLTCNRQPATNSYYGHLRTGYLIA
FT                   LGIALHDFPEGLAIAAGFATASKLGPALVLAIGLHNIPEGMATAAPLWLGKQSAKRIIG
FT                   INLLVSLVTPAGTLAGLWLLQLADYFISILLSFAAGAMTYIVFAKLFPESFNQHRRLAL
FT                   TGGFCGMLFFLLLSLLE"
     MAEIMILSLI AGLGTCLGAA LVITFGQINS KSLSVFLGLA CGVMIAVILF DLLPAAYFYG        60
     NIFSCLGGFC GGLLLLLLLE LLTCNRQPAT NSYYGHLRTG YLIALGIALH DFPEGLAIAA       120
     GFATASKLGP ALVLAIGLHN IPEGMATAAP LWLGKQSAKR IIGINLLVSL VTPAGTLAGL       180
     WLLQLADYFI SILLSFAAGA MTYIVFAKLF PESFNQHRRL ALTGGFCGML FFLLLSLLE        239
//

If you have problems or comments...

PBIL Back to PBIL home page