(data stored in ACNUC7421 zone)

EMBL: CP001720.PE188

CP001720.PE188       Location/Qualifiers
FT   CDS             complement(218935..219462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0200"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein;
FT                   Peptidoglycan-binding LysM; SMART: Peptidoglycan-binding
FT                   LysM; KEGG: bsu:BSU14040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61153"
FT                   /db_xref="GOA:C8W2Z7"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z7"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACV61153.1"
FT                   /translation="MSNSINQINIHTGTRILNIKANNLSRNYPAAVGKPATPTPTGNYS
FT                   VVNKIINPGGMLGTRWLGLNIPGGVYGIHGTNNPDSIGKAVSNGCIRMQNQDIEEIFPY
FT                   IAIGTRVTINDYYTNPTEVSNGKSLTEYIVKQGDSLWLIAQKNNILLDKLIIANPHINP
FT                   DHIFPGQTVIIP"
     MSNSINQINI HTGTRILNIK ANNLSRNYPA AVGKPATPTP TGNYSVVNKI INPGGMLGTR        60
     WLGLNIPGGV YGIHGTNNPD SIGKAVSNGC IRMQNQDIEE IFPYIAIGTR VTINDYYTNP       120
     TEVSNGKSLT EYIVKQGDSL WLIAQKNNIL LDKLIIANPH INPDHIFPGQ TVIIP            175
//

If you have problems or comments...

PBIL Back to PBIL home page