(data stored in ACNUC7421 zone)

EMBL: CP001720.PE189

CP001720.PE189       Location/Qualifiers
FT   CDS             219699..220661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0201"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritolkinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="KEGG: baa:BA_0633 4-diphosphocytidyl-2-C-methyl-D-
FT                   erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61154"
FT                   /db_xref="GOA:C8W2Z8"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z8"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ACV61154.1"
FT                   /translation="MPLVIPAYAKINLCLDVLGRRDDGYHEVEMVMQSISLHDLLELSL
FT                   SEEQENNNMGKIILTVAGADLPVGEENLVFRTARILQEYTGCRLGCSILLHKKIPVAAG
FT                   LAGGSADAAAALLGLNKLWNLDLTVAELYALAAKIGSDVPFCIKGGTVLAKGRGEQLAF
FT                   LEAAPDMGIILVKPAYGISTGEVYSKLNSAVYPQVINTMQKKDITNDTNDIHNMLCLSD
FT                   LGPPVLRMIKAIKSRQLPAVCKALYNILEEPAMKMHPNLLDIKNILFEQGAMGVLMSGS
FT                   GSTIFGITPDLEAAHLLSKGLSPSLGSIYAVKLQGAREV"
     MPLVIPAYAK INLCLDVLGR RDDGYHEVEM VMQSISLHDL LELSLSEEQE NNNMGKIILT        60
     VAGADLPVGE ENLVFRTARI LQEYTGCRLG CSILLHKKIP VAAGLAGGSA DAAAALLGLN       120
     KLWNLDLTVA ELYALAAKIG SDVPFCIKGG TVLAKGRGEQ LAFLEAAPDM GIILVKPAYG       180
     ISTGEVYSKL NSAVYPQVIN TMQKKDITND TNDIHNMLCL SDLGPPVLRM IKAIKSRQLP       240
     AVCKALYNIL EEPAMKMHPN LLDIKNILFE QGAMGVLMSG SGSTIFGITP DLEAAHLLSK       300
     GLSPSLGSIY AVKLQGAREV                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page