(data stored in ACNUC7421 zone)

EMBL: CP001720.PE191

CP001720.PE191       Location/Qualifiers
FT   CDS             221465..222238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: net:Neut_1101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61156"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C8W300"
FT                   /inference="similar to AA sequence:KEGG:Neut_1101"
FT                   /protein_id="ACV61156.1"
FT                   /translation="MVDAVVLAGSVNNGKLRAISDVPYDALLPIGSKFMIEYVLEALLR
FT                   ARLVNRVIVAGPGNDPSQYLNKLLSNRNNRVKTAPAGASLMETFSSGVALLPGAERVLV
FT                   VTADLPLLTPEAVDCFIELCLEEAADLFYPIISREAVERCYSKTHRTYVTLREGVYTGG
FT                   NIFLVNPSAAKTCLHKGQEIVNLRKSPFKLCRLVGFMFLLRFLTKTLSLEEGERKVSSL
FT                   LGIKGRVIVLDYPEVGVDVDKPEDLELVKQVLGVV"
     MVDAVVLAGS VNNGKLRAIS DVPYDALLPI GSKFMIEYVL EALLRARLVN RVIVAGPGND        60
     PSQYLNKLLS NRNNRVKTAP AGASLMETFS SGVALLPGAE RVLVVTADLP LLTPEAVDCF       120
     IELCLEEAAD LFYPIISREA VERCYSKTHR TYVTLREGVY TGGNIFLVNP SAAKTCLHKG       180
     QEIVNLRKSP FKLCRLVGFM FLLRFLTKTL SLEEGERKVS SLLGIKGRVI VLDYPEVGVD       240
     VDKPEDLELV KQVLGVV                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page