(data stored in ACNUC7421 zone)

EMBL: CP001720.PE192

CP001720.PE192       Location/Qualifiers
FT   CDS             222584..222841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0204"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: bha:BH0064
FT                   regulatory protein SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61157"
FT                   /db_xref="GOA:C8W301"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:C8W301"
FT                   /inference="protein motif:PFAM:PF04026"
FT                   /protein_id="ACV61157.1"
FT                   /translation="MMHVTDVRVRKILAEGKMKAIVSVTLNDAFVIHDVKVVEGQTGLF
FT                   VAMPSRKTPNGEFRDIAHPINSSAREIIQVAVLQAYEETV"
     MMHVTDVRVR KILAEGKMKA IVSVTLNDAF VIHDVKVVEG QTGLFVAMPS RKTPNGEFRD        60
     IAHPINSSAR EIIQVAVLQA YEETV                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page