(data stored in ACNUC7421 zone)

EMBL: CP001720.PE193

CP001720.PE193       Location/Qualifiers
FT   CDS             223131..224507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0205"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: Nucleotidyl transferase; transferase hexapeptide
FT                   repeat containing protein; 4-diphosphocytidyl-
FT                   2C-methyl-D-erythritol synthase; KEGG: bha:BH0065
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61158"
FT                   /db_xref="GOA:C8W302"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C8W302"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ACV61158.1"
FT                   /translation="MKLAAVVLAAGKGTRMKSKIPKVLHKVSGLPMISHVLHSVSKAGI
FT                   EKKVVVVGYQGDQVAAQLGQDVNIAVQEEQLGTAHALLSAESMLRDFSGHILVLCGDTP
FT                   LIKPQTLKDLVSFHVDSASVATVLTAKLEDPTGYGRVIRDKAGSVAKIVEQKDASPVEL
FT                   NIQEINTGIYCFQSEFLFEALRHISPNNAQGEYYLTDIIQLYVSQGRLVSAIAVVDAAE
FT                   IQGINDRVHLAAAESVLRRQMLDKLMLGGVTVIDPASTFIDQTVEIGTDTVILPYTCIE
FT                   GNTVIGSDCIIGPHTRLSDTRIGNCVEIQNSVLLKSDVGDQSSIGPFAYIRPDTVIGEQ
FT                   VKVGDFVEIKKSNIGNKSKIPHLSYIGDSEIAENVNIGAGTITCNYDGVAKHRTTIEEG
FT                   AFIGSNTNLVAPVSVGAGAVIGAGSTITMDVPPGALGVARGKQKNINNWLSRKTPEKRD
FT                   "
     MKLAAVVLAA GKGTRMKSKI PKVLHKVSGL PMISHVLHSV SKAGIEKKVV VVGYQGDQVA        60
     AQLGQDVNIA VQEEQLGTAH ALLSAESMLR DFSGHILVLC GDTPLIKPQT LKDLVSFHVD       120
     SASVATVLTA KLEDPTGYGR VIRDKAGSVA KIVEQKDASP VELNIQEINT GIYCFQSEFL       180
     FEALRHISPN NAQGEYYLTD IIQLYVSQGR LVSAIAVVDA AEIQGINDRV HLAAAESVLR       240
     RQMLDKLMLG GVTVIDPAST FIDQTVEIGT DTVILPYTCI EGNTVIGSDC IIGPHTRLSD       300
     TRIGNCVEIQ NSVLLKSDVG DQSSIGPFAY IRPDTVIGEQ VKVGDFVEIK KSNIGNKSKI       360
     PHLSYIGDSE IAENVNIGAG TITCNYDGVA KHRTTIEEGA FIGSNTNLVA PVSVGAGAVI       420
     GAGSTITMDV PPGALGVARG KQKNINNWLS RKTPEKRD                               458
//

If you have problems or comments...

PBIL Back to PBIL home page