(data stored in ACNUC7421 zone)

EMBL: CP001720.PE197

CP001720.PE197       Location/Qualifiers
FT   CDS             227264..227854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0209"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="KEGG: baa:BA_0639 peptidyl-tRNA hydrolase; TIGRFAM:
FT                   peptidyl-tRNA hydrolase; PFAM: peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61162"
FT                   /db_xref="GOA:C8W306"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:C8W306"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ACV61162.1"
FT                   /translation="MKLIVGLGNPGIEYRNTRHNIGFMVIDQLAEKYGVDVQKKMMRSV
FT                   LGQGWLGSQKVILAKPLTYMNLSGQSVQALMNWYKLTAQELLVICDDLNLEAGHLRLRK
FT                   KGSDGGHNGLKSIIQALGTSDFPRLRLGIGRPSHPGQEQVSFVLGKFAPQEAELLSQLI
FT                   GRGEQAAAVWVENGIDAAMNEFNRSRREDKEDK"
     MKLIVGLGNP GIEYRNTRHN IGFMVIDQLA EKYGVDVQKK MMRSVLGQGW LGSQKVILAK        60
     PLTYMNLSGQ SVQALMNWYK LTAQELLVIC DDLNLEAGHL RLRKKGSDGG HNGLKSIIQA       120
     LGTSDFPRLR LGIGRPSHPG QEQVSFVLGK FAPQEAELLS QLIGRGEQAA AVWVENGIDA       180
     AMNEFNRSRR EDKEDK                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page