(data stored in ACNUC7421 zone)

EMBL: CP001720.PE2

CP001720.PE2         Location/Qualifiers
FT   CDS             1591..2694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: baa:BA_0597 DNA polymerase III beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60967"
FT                   /db_xref="GOA:C8VV98"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C8VV98"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACV60967.1"
FT                   /translation="MKFISTKDNLLYAIQTVQKAVSPKSLLPILSGILFKAYDNTLIVR
FT                   ATDLELGIECFLPVKVIETGEIVLPSKYIIDIIRRLPDTVIEFESNDYLNSITIKYKNS
FT                   QANIHGFAADEFPMLPPLNDGFTFLISTSIFKKMLRQTIFATGTDENRPVFTGIHFQIL
FT                   EQEFKMVATDTHRLAMITEHLPLIKQELPGIIVPGKTLSELLKILNSTQDEEIKITVTE
FT                   NQIFFLLNEINIISRLIKGQYPNYHHVIPKDIIAKIKIKLSDFIQSVERASLLSSSISQ
FT                   HIRIDCENSDFIVISSNNEAGHIYEEIPVFFEGEALQIYFNSKYLMDALKAVDSEEIYL
FT                   ELSGPINPCLLRTEDRNYLSILLPVRP"
     MKFISTKDNL LYAIQTVQKA VSPKSLLPIL SGILFKAYDN TLIVRATDLE LGIECFLPVK        60
     VIETGEIVLP SKYIIDIIRR LPDTVIEFES NDYLNSITIK YKNSQANIHG FAADEFPMLP       120
     PLNDGFTFLI STSIFKKMLR QTIFATGTDE NRPVFTGIHF QILEQEFKMV ATDTHRLAMI       180
     TEHLPLIKQE LPGIIVPGKT LSELLKILNS TQDEEIKITV TENQIFFLLN EINIISRLIK       240
     GQYPNYHHVI PKDIIAKIKI KLSDFIQSVE RASLLSSSIS QHIRIDCENS DFIVISSNNE       300
     AGHIYEEIPV FFEGEALQIY FNSKYLMDAL KAVDSEEIYL ELSGPINPCL LRTEDRNYLS       360
     ILLPVRP                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page