(data stored in ACNUC7421 zone)

EMBL: CP001720.PE20

CP001720.PE20        Location/Qualifiers
FT   CDS             22461..23162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0021"
FT                   /product="LrgB family protein"
FT                   /note="PFAM: LrgB family protein; KEGG: tcx:Tcr_1938
FT                   LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60985"
FT                   /db_xref="GOA:C8VVB6"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVB6"
FT                   /inference="protein motif:PFAM:PF04172"
FT                   /protein_id="ACV60985.1"
FT                   /translation="MDKFFISPLFLVGLTLACYFVSLSFYKKYRLLLFHPVPLSSLIII
FT                   LFLYNRGINYITYEKATGFISFFLGPATLALGYNLYRDFSMIRRRVWPILLGSFCGAIA
FT                   GVFSVYILGKLLCINQSIIFSFLPKSTTTPIALAIATKYGGIGSLTVAAVVVTGILGAL
FT                   IGPEFLTLTGIRDNTARGLAMGSAAHAIGTSRALQENSEQGSLAGLAIILCGLFTALII
FT                   SMINIFKEYIF"
     MDKFFISPLF LVGLTLACYF VSLSFYKKYR LLLFHPVPLS SLIIILFLYN RGINYITYEK        60
     ATGFISFFLG PATLALGYNL YRDFSMIRRR VWPILLGSFC GAIAGVFSVY ILGKLLCINQ       120
     SIIFSFLPKS TTTPIALAIA TKYGGIGSLT VAAVVVTGIL GALIGPEFLT LTGIRDNTAR       180
     GLAMGSAAHA IGTSRALQEN SEQGSLAGLA IILCGLFTAL IISMINIFKE YIF              233
//

If you have problems or comments...

PBIL Back to PBIL home page