(data stored in ACNUC7421 zone)

EMBL: CP001720.PE201

CP001720.PE201       Location/Qualifiers
FT   CDS             230547..230780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61166"
FT                   /db_xref="UniProtKB/TrEMBL:C8W310"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61166.1"
FT                   /translation="MKVYYVCECCDEVFDIVDSATCRESGQEPSLTGISVCGIINGVSS
FT                   SDGYYVSGICPDCREEINCGYDTVFYREPVIN"
     MKVYYVCECC DEVFDIVDSA TCRESGQEPS LTGISVCGII NGVSSSDGYY VSGICPDCRE        60
     EINCGYDTVF YREPVIN                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page