(data stored in ACNUC7421 zone)

EMBL: CP001720.PE202

CP001720.PE202       Location/Qualifiers
FT   CDS             230922..234515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0214"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: bsu:BSU00550 transcription-repair coupling
FT                   factor; TIGRFAM: transcription-repair coupling factor;
FT                   PFAM: transcription factor CarD; helicase domain protein;
FT                   TRCF domain protein; DEAD/DEAH box helicase domain protein;
FT                   type III restriction protein res subunit; SMART: DEAD-like
FT                   helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61167"
FT                   /db_xref="GOA:C8W311"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C8W311"
FT                   /inference="protein motif:TFAM:TIGR00580"
FT                   /protein_id="ACV61167.1"
FT                   /translation="MNGFVNGIKEWLLQPLINTPEFIDLQNGLAKNRRCQVVSGLSSAQ
FT                   KSFVIAGLVQAMRQTALIITASDQEAAGLTEDLKNLLPDLKVMTFPARRLLPYQVFAYS
FT                   KEILRQRMEVLESLCRGENPVIIAPVEALMRRLGPCADFCSARLELNVGQRYELPQMVS
FT                   CLHEHGYERVNLVESHGQFSVRGGILDIYPITGINPVRVEFFDDEVDSIRIFNPGTQRS
FT                   EENMSQMQIFPVREMVVRQGDWERAYQALSQEYQYRRRNLDKKSDSEVLDNLSRCEEVL
FT                   DNISQAKYFDSIEQYLPYFYDEDITLLNYIKAESLVLVDEPSRLQENTDLLQRERTETY
FT                   SELMKAGRVLPGQFKGYTDWAGIHKQITGFRAIYFSFLPRQASLWRSCNTVNFPVKTMQ
FT                   NFMGKVEMLAEEIRHYKMSRYGVVLLVKNSDRAAQLVLSLRDYDLEALYLKKDLSEYPH
FT                   LNVQEDMPDSKTKYKVDRGRGQIVILPMHLSNGFELVSGKLAVITETEIYGHRKKPSVQ
FT                   RQRVQDKMELFAELKTGDYVVHVNHGIGRYDGVVQLTIGDVKRDYLLVKYAGEDKLYIP
FT                   TDQVEMIQKYLGSEGGTPKLSRLGGAEWSRVKSKVKEAVKEMAQELLALYAAREAVQGH
FT                   PFSKDTVWQQEFEAAFPYEETPDQLKAIEEVKADMERPRPMDRLLCGDVGYGKTEVALR
FT                   AAFKAVMDGKQVAVLVPTTILAQQHFNTFKERFAKYPVNIAMLSRFITARRQRQIVQEL
FT                   LLGQVDIVIGTHRLVQDDIKFKDLGLVVVDEEQRFGVTHKEKLKQLRQNVDVLTLTATP
FT                   IPRTLHMSIVGVRDTSLLETPPEDRIPVQTYVLEEEPVIVREAIRRELGRGGQVYYVHN
FT                   RVADLDRVAGWLKGLVPDAAIAIGHGQMKEDRLENVMLDFMNKKFDILLCTTIIETGLD
FT                   IQNVNTLIVKDADYMGLAQLYQLRGRVGRTNRLAYAYCTFRGDKVMSELAEKRLSAVRE
FT                   FTEFGSGYKIAMRDLEIRGAGNILGPEQHGHIAAVGFDLYCRLLEEAVLEAKGGENAKP
FT                   IETLVELPVTAYIPDEYVIDLNQKVELYKRMANIRDIKMLSEMEDELIDRFGDIPEPVL
FT                   NLLAVTRIKALAVNLKIKNISRINGYYRLQFAASHDLTGEKLITVSEKYGGKVKFNHAE
FT                   GEFEIRLQTVSKDQETRLTMSRLESLLMNLL"
     MNGFVNGIKE WLLQPLINTP EFIDLQNGLA KNRRCQVVSG LSSAQKSFVI AGLVQAMRQT        60
     ALIITASDQE AAGLTEDLKN LLPDLKVMTF PARRLLPYQV FAYSKEILRQ RMEVLESLCR       120
     GENPVIIAPV EALMRRLGPC ADFCSARLEL NVGQRYELPQ MVSCLHEHGY ERVNLVESHG       180
     QFSVRGGILD IYPITGINPV RVEFFDDEVD SIRIFNPGTQ RSEENMSQMQ IFPVREMVVR       240
     QGDWERAYQA LSQEYQYRRR NLDKKSDSEV LDNLSRCEEV LDNISQAKYF DSIEQYLPYF       300
     YDEDITLLNY IKAESLVLVD EPSRLQENTD LLQRERTETY SELMKAGRVL PGQFKGYTDW       360
     AGIHKQITGF RAIYFSFLPR QASLWRSCNT VNFPVKTMQN FMGKVEMLAE EIRHYKMSRY       420
     GVVLLVKNSD RAAQLVLSLR DYDLEALYLK KDLSEYPHLN VQEDMPDSKT KYKVDRGRGQ       480
     IVILPMHLSN GFELVSGKLA VITETEIYGH RKKPSVQRQR VQDKMELFAE LKTGDYVVHV       540
     NHGIGRYDGV VQLTIGDVKR DYLLVKYAGE DKLYIPTDQV EMIQKYLGSE GGTPKLSRLG       600
     GAEWSRVKSK VKEAVKEMAQ ELLALYAARE AVQGHPFSKD TVWQQEFEAA FPYEETPDQL       660
     KAIEEVKADM ERPRPMDRLL CGDVGYGKTE VALRAAFKAV MDGKQVAVLV PTTILAQQHF       720
     NTFKERFAKY PVNIAMLSRF ITARRQRQIV QELLLGQVDI VIGTHRLVQD DIKFKDLGLV       780
     VVDEEQRFGV THKEKLKQLR QNVDVLTLTA TPIPRTLHMS IVGVRDTSLL ETPPEDRIPV       840
     QTYVLEEEPV IVREAIRREL GRGGQVYYVH NRVADLDRVA GWLKGLVPDA AIAIGHGQMK       900
     EDRLENVMLD FMNKKFDILL CTTIIETGLD IQNVNTLIVK DADYMGLAQL YQLRGRVGRT       960
     NRLAYAYCTF RGDKVMSELA EKRLSAVREF TEFGSGYKIA MRDLEIRGAG NILGPEQHGH      1020
     IAAVGFDLYC RLLEEAVLEA KGGENAKPIE TLVELPVTAY IPDEYVIDLN QKVELYKRMA      1080
     NIRDIKMLSE MEDELIDRFG DIPEPVLNLL AVTRIKALAV NLKIKNISRI NGYYRLQFAA      1140
     SHDLTGEKLI TVSEKYGGKV KFNHAEGEFE IRLQTVSKDQ ETRLTMSRLE SLLMNLL         1197
//

If you have problems or comments...

PBIL Back to PBIL home page