(data stored in ACNUC7421 zone)

EMBL: CP001720.PE203

CP001720.PE203       Location/Qualifiers
FT   CDS             234622..235605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0215"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: gsu:GSU2429 peptidyl-prolyl cis-trans isomerase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61168"
FT                   /db_xref="GOA:C8W312"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C8W312"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ACV61168.1"
FT                   /translation="MRKIRISLFLLLGVLLLTGCNTNVVATVNGEEITQQQLDKRVSIV
FT                   KDYYEKQYGQKIEGQDAQKLIDNMKPGLLDEMISDTLKRQEARKVGKDMTDQQIQEKID
FT                   GVKKQFPNEEAFKNFLAQQDLTEKDMAYMLNLQDVVLKDVKAPTEEEVQEYYDQNKEQF
FT                   KTAEQYEVRHILISTDPDDAGNVKHTEAEAEKLAVQVLADIKNGKDFAALAREKSEDLG
FT                   SKDNGGLYTFKKGDTVPEFEKAALALKPGEYTREPVKTQFGYHIIKLEKLIPARDQSFA
FT                   EVKDGIKQQLDQEAKKNKFNAYLEDLKKKAKITNKLAETGDNKSKD"
     MRKIRISLFL LLGVLLLTGC NTNVVATVNG EEITQQQLDK RVSIVKDYYE KQYGQKIEGQ        60
     DAQKLIDNMK PGLLDEMISD TLKRQEARKV GKDMTDQQIQ EKIDGVKKQF PNEEAFKNFL       120
     AQQDLTEKDM AYMLNLQDVV LKDVKAPTEE EVQEYYDQNK EQFKTAEQYE VRHILISTDP       180
     DDAGNVKHTE AEAEKLAVQV LADIKNGKDF AALAREKSED LGSKDNGGLY TFKKGDTVPE       240
     FEKAALALKP GEYTREPVKT QFGYHIIKLE KLIPARDQSF AEVKDGIKQQ LDQEAKKNKF       300
     NAYLEDLKKK AKITNKLAET GDNKSKD                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page