(data stored in ACNUC7421 zone)

EMBL: CP001720.PE214

CP001720.PE214       Location/Qualifiers
FT   CDS             241868..242848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0226"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: mxa:MXAN_5759
FT                   phosphatase, Ppx/GppA family"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61179"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3S5"
FT                   /inference="protein motif:PFAM:PF02541"
FT                   /protein_id="ACV61179.1"
FT                   /translation="MIMHSFIGMFFIVYNQWGEMMTIVGAIDIGTNSTRLLVAEISEAG
FT                   KIRVLHSDMRTTRLGENIRERVLLWPAMERTLEVLKKFIRDAVDLNVACVILAATSAVR
FT                   DAANKEEFISLIKRETGHEINILSGAEEARLSYLGVVSGLDNNYEQVTVMDVGGGSTEF
FT                   TWSAPKGLVFKSFNVGAVRMTESNDSYEQIYDNLSNQIKLAGESLMPEETASLPTALVG
FT                   VGGTVTTMAAIRLGLRVYNPELVHGSKLNIGDVSAILNLLIGCDLEARKQIYGLQPERA
FT                   DIIIAGVRIVHCAMTILKQAVITVSESDILHGLALAAANIVEIKL"
     MIMHSFIGMF FIVYNQWGEM MTIVGAIDIG TNSTRLLVAE ISEAGKIRVL HSDMRTTRLG        60
     ENIRERVLLW PAMERTLEVL KKFIRDAVDL NVACVILAAT SAVRDAANKE EFISLIKRET       120
     GHEINILSGA EEARLSYLGV VSGLDNNYEQ VTVMDVGGGS TEFTWSAPKG LVFKSFNVGA       180
     VRMTESNDSY EQIYDNLSNQ IKLAGESLMP EETASLPTAL VGVGGTVTTM AAIRLGLRVY       240
     NPELVHGSKL NIGDVSAILN LLIGCDLEAR KQIYGLQPER ADIIIAGVRI VHCAMTILKQ       300
     AVITVSESDI LHGLALAAAN IVEIKL                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page