(data stored in ACNUC7421 zone)

EMBL: CP001720.PE215

CP001720.PE215       Location/Qualifiers
FT   CDS             242863..245418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0227"
FT                   /product="stage II sporulation protein E, protein
FT                   serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: bar:GBAA0061 stage II sporulation protein E;
FT                   TIGRFAM: stage II sporulation protein E; PFAM: Stage II
FT                   sporulation E family protein; SMART: protein phosphatase 2C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61180"
FT                   /db_xref="GOA:C8W3S6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3S6"
FT                   /inference="protein motif:TFAM:TIGR02865"
FT                   /protein_id="ACV61180.1"
FT                   /translation="MTKYSHTIVYNKTVGKLYTRGGLILFEKTDAYPYSREYGTKKTAT
FT                   PKTKEMFSDYQWFRLNQLFNWNSLMVFILGFFMGRVVLLGELMPFGPAFVSAGLSLGFG
FT                   PAVVLGAVAGLFSVLQGMELVARFVIIVCLVGVYYSVPKNLRAHPVVLPGVVGAVALVV
FT                   RTVYLSMSDPVPYNYVSSAFEAFIAALLSFVYLRSLPLLTLVCGERTKKLSAERVFYLL
FT                   LLLGGLIAGSAGIGYANITLQGLLSRLVVLIAAYAGGTGMGAAVGALVGVLPGLVFTAM
FT                   PALVGAYSFAGLLAGFSRRFGKAGSILGFVLGNIILCVYMSGYDRLTGVLGETGLASLI
FT                   FFLLPDRIMRCWSSLRTENHMPLVDSGDKDCPQNNRFKEILAYRIQGMATVFQELFKSY
FT                   EQSALADLSTHEDRSPQDLVDEIVRRVCGDCPLHRICWEKDFYRTYQYLLDMLARAEAS
FT                   DSRDLDNIPQFLRSRCTRIKELWLTVLCLNELYSAKKLWFGRMKKSREIISEQLKTVCH
FT                   ITDKLVEELQASAGLFEHHDFDLLASLKEKGLDIFDVYTTRQPGGHLEVVINMPSCRGM
FT                   INCRYKVAPVLTELLGQPYSVVGMNCFSHQKGTERNIMGQESAGYCNFRLYPSLLYRLE
FT                   VGMARSGKGGSDICGDSYSVVYLNQGKVALILSDGMGSGVSAELESSMTIRLLERLLKS
FT                   GLEREPAIRMVNSVMLMRSAEDSFATIDLVIIDLCNGSSEFVKIGAPPGYLVRGKRVAP
FT                   ITSSALPIGIIDDIEITTVAKTLVDGDMLVMVTDGVTDACRTSDHEEDWLLKVLPETRN
FT                   LPPQEVAEFIMQLAQTCSEKDNKYDDMIVMAVRIEKEGI"
     MTKYSHTIVY NKTVGKLYTR GGLILFEKTD AYPYSREYGT KKTATPKTKE MFSDYQWFRL        60
     NQLFNWNSLM VFILGFFMGR VVLLGELMPF GPAFVSAGLS LGFGPAVVLG AVAGLFSVLQ       120
     GMELVARFVI IVCLVGVYYS VPKNLRAHPV VLPGVVGAVA LVVRTVYLSM SDPVPYNYVS       180
     SAFEAFIAAL LSFVYLRSLP LLTLVCGERT KKLSAERVFY LLLLLGGLIA GSAGIGYANI       240
     TLQGLLSRLV VLIAAYAGGT GMGAAVGALV GVLPGLVFTA MPALVGAYSF AGLLAGFSRR       300
     FGKAGSILGF VLGNIILCVY MSGYDRLTGV LGETGLASLI FFLLPDRIMR CWSSLRTENH       360
     MPLVDSGDKD CPQNNRFKEI LAYRIQGMAT VFQELFKSYE QSALADLSTH EDRSPQDLVD       420
     EIVRRVCGDC PLHRICWEKD FYRTYQYLLD MLARAEASDS RDLDNIPQFL RSRCTRIKEL       480
     WLTVLCLNEL YSAKKLWFGR MKKSREIISE QLKTVCHITD KLVEELQASA GLFEHHDFDL       540
     LASLKEKGLD IFDVYTTRQP GGHLEVVINM PSCRGMINCR YKVAPVLTEL LGQPYSVVGM       600
     NCFSHQKGTE RNIMGQESAG YCNFRLYPSL LYRLEVGMAR SGKGGSDICG DSYSVVYLNQ       660
     GKVALILSDG MGSGVSAELE SSMTIRLLER LLKSGLEREP AIRMVNSVML MRSAEDSFAT       720
     IDLVIIDLCN GSSEFVKIGA PPGYLVRGKR VAPITSSALP IGIIDDIEIT TVAKTLVDGD       780
     MLVMVTDGVT DACRTSDHEE DWLLKVLPET RNLPPQEVAE FIMQLAQTCS EKDNKYDDMI       840
     VMAVRIEKEG I                                                            851
//

If you have problems or comments...

PBIL Back to PBIL home page