(data stored in ACNUC7421 zone)

EMBL: CP001720.PE216

CP001720.PE216       Location/Qualifiers
FT   CDS             245882..247303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0228"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: sat:SYN_02776
FT                   tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61181"
FT                   /db_xref="GOA:C8W3S7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3S7"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ACV61181.1"
FT                   /translation="MTGTLKQVLKYINKHRMVNKGDKILLAVSGGPDSVAMLDVLFCLR
FT                   HDLGISLHIAHLNHMFRGEESLGDAEFVRELAVRYNLPVTVRHINVPSFMEKTGLSSQP
FT                   AARTVRYSFLDETAAQESASRIALAHHADDQAETVMLHFLRGSGAAGLRGMLPVRDNFY
FT                   IRPMLCLKRQDIEDYCKKKNLRWRVDSSNLKTDYRRNKIRMYLLPLLEKEYNNNLTATL
FT                   NRLADIFREEEDYLELMTRNEYNNLTVLKSAGEICLNLKGFQQVPLALQRRILRLAWRE
FT                   ITGGFRDLAFEQLGKAVILLTNHVGSGSLEFPRDVKVVKRYDSFSFIIGKDKQDGLSYY
FT                   YDLPVPGKVYLAEINRTLFCEVADTQAMDEKYDKSFLNRRRFSQDEAWLDYERVAFPLC
FT                   VRGRQPGDIFEPLGLTGSMKLKKYFINQKVPCEVRDKVPLVIGEGKIIWVGGMQISESV
FT                   KINEVTTKFLHLFLV"
     MTGTLKQVLK YINKHRMVNK GDKILLAVSG GPDSVAMLDV LFCLRHDLGI SLHIAHLNHM        60
     FRGEESLGDA EFVRELAVRY NLPVTVRHIN VPSFMEKTGL SSQPAARTVR YSFLDETAAQ       120
     ESASRIALAH HADDQAETVM LHFLRGSGAA GLRGMLPVRD NFYIRPMLCL KRQDIEDYCK       180
     KKNLRWRVDS SNLKTDYRRN KIRMYLLPLL EKEYNNNLTA TLNRLADIFR EEEDYLELMT       240
     RNEYNNLTVL KSAGEICLNL KGFQQVPLAL QRRILRLAWR EITGGFRDLA FEQLGKAVIL       300
     LTNHVGSGSL EFPRDVKVVK RYDSFSFIIG KDKQDGLSYY YDLPVPGKVY LAEINRTLFC       360
     EVADTQAMDE KYDKSFLNRR RFSQDEAWLD YERVAFPLCV RGRQPGDIFE PLGLTGSMKL       420
     KKYFINQKVP CEVRDKVPLV IGEGKIIWVG GMQISESVKI NEVTTKFLHL FLV              473
//

If you have problems or comments...

PBIL Back to PBIL home page