(data stored in ACNUC7421 zone)

EMBL: CP001720.PE218

CP001720.PE218       Location/Qualifiers
FT   CDS             249306..249755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0230"
FT                   /product="Nucleoside-diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="KEGG: YNK1; Nucleoside diphosphate kinase, catalyzes
FT                   the transfer of gamma phosphates from nucleoside
FT                   triphosphates, usually ATP, to nucleoside diphosphates by a
FT                   mechanism that involves formation of an autophosphorylated
FT                   enzyme in-TRUNCATED-; PFAM: nucleoside diphosphate kinase;
FT                   SMART: nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61183"
FT                   /db_xref="GOA:C8W3S9"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3S9"
FT                   /inference="protein motif:PRIAM:2.7.4.6"
FT                   /protein_id="ACV61183.1"
FT                   /translation="MERTFVMVKPDGVQRGLVAKVINSFEQKGCKLVALKMMKIDRELA
FT                   EKHYGEHKGKPFFTPLVDYIISGPVVAMVLEGKDVITAARNVMGATNPLQAAIGTIRGD
FT                   YGMDIGRNVVHGSDSPASAQREINLFFLPEEITEWSRTLETWIFE"
     MERTFVMVKP DGVQRGLVAK VINSFEQKGC KLVALKMMKI DRELAEKHYG EHKGKPFFTP        60
     LVDYIISGPV VAMVLEGKDV ITAARNVMGA TNPLQAAIGT IRGDYGMDIG RNVVHGSDSP       120
     ASAQREINLF FLPEEITEWS RTLETWIFE                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page