(data stored in ACNUC7421 zone)

EMBL: CP001720.PE219

CP001720.PE219       Location/Qualifiers
FT   CDS             250102..251805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0231"
FT                   /product="Formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="PFAM: formate-tetrahydrofolate ligase FTHFS; KEGG:
FT                   fthS; formate-dihydrofolate ligase ; K01938
FT                   formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61184"
FT                   /db_xref="GOA:C8W3T0"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3T0"
FT                   /inference="protein motif:PRIAM:6.3.4.3"
FT                   /protein_id="ACV61184.1"
FT                   /translation="MKVVPSDLEIVQAHKMTPIGEIAAKMGLTEDDFDYYGKYKAKISL
FT                   DVIEKFKDRPNAKLIDVTAITPTPLGEGKTVTTISLTQGLGHIGKKVICTLRQPSLGPV
FT                   FGIKGGAAGGGYAQVVPMEDLNIHFTGDIHAIETANNLLAAMIDTSILLDNPLNIDPMS
FT                   IMWRRVFDLNDRALRDIVIGLGGKENGYPRQTGFDIAVASEVMAILALTTSLQDMRERF
FT                   ARIIFGFTYDGKPVTAEQIKAAGSMTVIMKEAIKPNLVQTLEGQPCIMHAGPFANIAHG
FT                   QNSVLADMIALKCADYVVTESGFGADMGMQKFMDIKCRQSGLRPNCVVVTSTVRSLKMH
FT                   GGVGNIVAGKPLPKELTEENLPALEKGAANMMHMIKIAKGYGIPVVVSINRFITDTDNE
FT                   INLLKDKAKEAGAFGVGVNTAWGDGGVGCAEVAELVVKACEEPTDFQFLYPDSFTIKEK
FT                   IETMAKKIYNADGVSYDPLAEKKIAQFEELGLGNLPINMAKTHLSISHDPGMKNVPSGY
FT                   IFPIRDIRASVGAGFLYPLAGAMRTMPGLGRAPSAIKVDIDKDGKIVGLF"
     MKVVPSDLEI VQAHKMTPIG EIAAKMGLTE DDFDYYGKYK AKISLDVIEK FKDRPNAKLI        60
     DVTAITPTPL GEGKTVTTIS LTQGLGHIGK KVICTLRQPS LGPVFGIKGG AAGGGYAQVV       120
     PMEDLNIHFT GDIHAIETAN NLLAAMIDTS ILLDNPLNID PMSIMWRRVF DLNDRALRDI       180
     VIGLGGKENG YPRQTGFDIA VASEVMAILA LTTSLQDMRE RFARIIFGFT YDGKPVTAEQ       240
     IKAAGSMTVI MKEAIKPNLV QTLEGQPCIM HAGPFANIAH GQNSVLADMI ALKCADYVVT       300
     ESGFGADMGM QKFMDIKCRQ SGLRPNCVVV TSTVRSLKMH GGVGNIVAGK PLPKELTEEN       360
     LPALEKGAAN MMHMIKIAKG YGIPVVVSIN RFITDTDNEI NLLKDKAKEA GAFGVGVNTA       420
     WGDGGVGCAE VAELVVKACE EPTDFQFLYP DSFTIKEKIE TMAKKIYNAD GVSYDPLAEK       480
     KIAQFEELGL GNLPINMAKT HLSISHDPGM KNVPSGYIFP IRDIRASVGA GFLYPLAGAM       540
     RTMPGLGRAP SAIKVDIDKD GKIVGLF                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page