(data stored in ACNUC7421 zone)

EMBL: CP001720.PE224

CP001720.PE224       Location/Qualifiers
FT   CDS             256357..256722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0236"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; PFAM:
FT                   dihydroneopterin aldolase; KEGG: baa:BA_0662
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61189"
FT                   /db_xref="GOA:C8W3T5"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3T5"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ACV61189.1"
FT                   /translation="MSDKIILSGLDFYGYHGVLPEEQRLGQKFIIDLELSLSLREAGIK
FT                   DDPDLTVNYARVFETVREVVVGKPFFLIEALAEAIAFKVLKNFSIEKVLVRVRKPQAPV
FT                   PGCFEHMAVEITREKEV"
     MSDKIILSGL DFYGYHGVLP EEQRLGQKFI IDLELSLSLR EAGIKDDPDL TVNYARVFET        60
     VREVVVGKPF FLIEALAEAI AFKVLKNFSI EKVLVRVRKP QAPVPGCFEH MAVEITREKE       120
     V                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page