(data stored in ACNUC7421 zone)

EMBL: CP001720.PE226

CP001720.PE226       Location/Qualifiers
FT   CDS             257654..258676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0238"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: bha:BH2808
FT                   spore photoproduct lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61191"
FT                   /db_xref="GOA:C8W3T7"
FT                   /db_xref="InterPro:IPR023897"
FT                   /db_xref="InterPro:IPR034559"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3T7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV61191.1"
FT                   /translation="MTYQPQRVYFEREALNYPLGERLYREFSQQKIDIKLTGSHNRVTG
FT                   IPGKTAREAYLEGKNTMVVGVRRTLNFETCKPSAHYQLPLVTGCSGMCEYCYLNTNMGK
FT                   KPYIRVYVNIEEILQQVDKCIEERKPEITFFEGAANSDPLSVEKYTGLLERTIEFFANR
FT                   SYGRFRFVTKFSEVDSLLGIEHNGHTRWRFSLNAENIIKKYEHRSTSLRDRVKAASKVA
FT                   QSGYPLGFIIAPVIYYPGWQKDYRDMLLLLSSKLSTFDEAATEFEIITHRYTARAKNNI
FT                   LEIFPDTSLPMVEEGRRFKFGQFGYGKYVYPQEQMTEIKEFFSAQLNELFPQSRLKYLV
FT                   "
     MTYQPQRVYF EREALNYPLG ERLYREFSQQ KIDIKLTGSH NRVTGIPGKT AREAYLEGKN        60
     TMVVGVRRTL NFETCKPSAH YQLPLVTGCS GMCEYCYLNT NMGKKPYIRV YVNIEEILQQ       120
     VDKCIEERKP EITFFEGAAN SDPLSVEKYT GLLERTIEFF ANRSYGRFRF VTKFSEVDSL       180
     LGIEHNGHTR WRFSLNAENI IKKYEHRSTS LRDRVKAASK VAQSGYPLGF IIAPVIYYPG       240
     WQKDYRDMLL LLSSKLSTFD EAATEFEIIT HRYTARAKNN ILEIFPDTSL PMVEEGRRFK       300
     FGQFGYGKYV YPQEQMTEIK EFFSAQLNEL FPQSRLKYLV                             340
//

If you have problems or comments...

PBIL Back to PBIL home page