(data stored in ACNUC7421 zone)

EMBL: CP001720.PE228

CP001720.PE228       Location/Qualifiers
FT   CDS             259964..260806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0240"
FT                   /product="3-methyl-2-oxobutanoatehydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="KEGG: sat:SYN_02773 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; PFAM: Ketopantoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61193"
FT                   /db_xref="GOA:C8W3T9"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3T9"
FT                   /inference="protein motif:TFAM:TIGR00222"
FT                   /protein_id="ACV61193.1"
FT                   /translation="MTGSKVTTATFRNMKQEKRPVTMLTVYDYPMAKMLDAAGIDALLV
FT                   GDSLGNVVLGYDSTIPVTMDDMVHHVKAVCRGVQKAMVVADMPFLSYHLSRETAVKNAG
FT                   RFLQEAGAQAVKLEGGIEVCENVRAIVNAGIPVMGHLGLTPQSVHQMGGYKVQGKDETA
FT                   AEKLLSDANALVQAGVFSIVLECVPVPLAKLVTESVPVTTIGIGAGPFCDGQVLVTHDM
FT                   LDIYGNKAPKFVKRFASLYQIIMDALSAYKEEVQNGSFPSAEYGFSMSNDVLEKIKGQ"
     MTGSKVTTAT FRNMKQEKRP VTMLTVYDYP MAKMLDAAGI DALLVGDSLG NVVLGYDSTI        60
     PVTMDDMVHH VKAVCRGVQK AMVVADMPFL SYHLSRETAV KNAGRFLQEA GAQAVKLEGG       120
     IEVCENVRAI VNAGIPVMGH LGLTPQSVHQ MGGYKVQGKD ETAAEKLLSD ANALVQAGVF       180
     SIVLECVPVP LAKLVTESVP VTTIGIGAGP FCDGQVLVTH DMLDIYGNKA PKFVKRFASL       240
     YQIIMDALSA YKEEVQNGSF PSAEYGFSMS NDVLEKIKGQ                             280
//

If you have problems or comments...

PBIL Back to PBIL home page